SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015204 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015204
Domain Number 1 Region: 1078-1191
Classification Level Classification E-value
Superfamily SEA domain 3.27e-19
Family SEA domain 0.0086
Further Details:      
 
Domain Number 2 Region: 252-345
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000379
Family SEA domain 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000015204
Domain Number - Region: 1201-1278
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0306
Family Growth factor receptor domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015204   Gene: ENSMGAG00000014370   Transcript: ENSMGAT00000016153
Sequence length 1422
Comment pep:novel chromosome:UMD2:1:89264163:89315906:-1 gene:ENSMGAG00000014370 transcript:ENSMGAT00000016153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAFLWKISFCLLVSEVITGDLQAIAAEEKQAKDASPTPQLSVWQFASSSLPPELRKLHG
IVEAEQVNRHSLRRRKRSILFPSGVKICPDESVEQAIANHLKYFRLRVCQETVWEVFKTF
WDRLPEREEYHTWMSLCEEGTMSIFEMGMNFSQSEEHRSLIVKKLSYTKEAMAGSCTDWS
CGGTPTPASDADVTTLRDSDAAANVPPPHEVSIESPPGGTSHEIEDADTTINNEIKKEDE
TPVRPVTEQMIEFSIVIAGEKYSEELSDPDTAKYQLLSEQFVSQIQNVFEGLPGYKNIHV
LEFSSPEEDSQSGVEVHYAVTFDGEAISNATWDLINLHSNKVEDNSFMGIEDNPTVVYTI
SDFQDYIAEILQKNALLENTSLTLDPNSLQLINVKEILHPTQEDPSWITEHPTVLEHVEF
DDNTFSAERPSADESTVSNTLPFDFTKPDSTLDSEESNDNEIRPRPERLDSEVSLIPEAP
LSSEADITSLPDGLNLEDGNQTPALVTAPVIDHDSLDSLEWLSAPDSSDEFEDTGLSDDF
LLPSSPPSYLAPEEPPSTDDYTAPLLSAPTVASSSVVETDTRTVTAEKEEVTQGSPADSS
SADSLLHESVEESPFPLERENDIYLGDRIIFDDGSGSAFDGSGKGMEPSIWPWDMATLEP
VFYPGPDSWLDDDNDSLLIRTEDIPEGLILDYILNSRNKLEDDPSKDENEGVANIKENFL
DESEIFVFPETTTQQVPLLQTGEPSSVEPTTQMETLSMDDSSFVKPSFVLEPSEDYSFAD
LPTGEDPFLPHSTGLSVEDSLLTSTVTLGMEDRLLTSTVALSVEQSEEYSVGQEIISEAV
EHQNEDRPTEEELFTAEQSNVAEASTTGYLDKSSLETVLTVESFEVSTDSSTEEHQTLDS
SLADRDTGLAIKKPVDVWPTDRVLEKTLDQTVQSAMPTAAQVSTAVPSLIDQATALDGFA
GQDGTEHDTHVSMSISTILKSYVTVTAGTVELPSHLPPVASTVSSSVVTSAKLGGETTRV
LDVSVDLDHVSMVSFSPEPSEEAKSMTDSHVEPTTHAHSTEMAGVAWPTHENHNSTPVPS
RALVVFFSLRVTNMMFSEDLFNKNSPEYKALEQRFLELLVPYLQSNLTGFQNLEILNFRN
GSIVVNSRMKFAKPVPRNVTNAVYMILEDFCNTAYHTMNLAIDKYSLDVESGEQADPCKF
QACNEFSECLVNRWSGEAECVCNPGYLSIDGLPCNSICDLQPNFCLNDGKCDISPGQGAI
CSRCRVGENWWYRGEHCEEYVSEPLVVGIAIASVAGFLLVASAVIFFLARTLRDQYTKSD
TEDSQGQGDSLSSIENAVKYNPMYESDTTGYSHYYRRYPQLTSYSSTSAETSTDYSSEEI
RHIYENSELTKEEIQDRIRIIELYAKDRQFAEFVRQHQMKLL
Download sequence
Identical sequences G1NNH9
ENSMGAP00000015204 ENSMGAP00000015204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]