SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015231 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015231
Domain Number 1 Region: 14-167
Classification Level Classification E-value
Superfamily EF-hand 1.5e-39
Family Calmodulin-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015231   Gene: ENSMGAG00000014394   Transcript: ENSMGAT00000016180
Sequence length 187
Comment pep:novel chromosome:UMD2:1:91922512:91942269:-1 gene:ENSMGAG00000014394 transcript:ENSMGAT00000016180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGANESLPGDGPIPEMHHYYSKFMRECPSGQLSLHEFKKLLDLQGLDPQGDLYIKRVFDI
FDLNQDGFIDFLEFIAAINLVIRGKIDQKLKWYFKLYDADGNGCIDKKELLSIFAAIQAI
NGQTNMTAEEFTNMIFQKIDVNNDGELTLEEFITGVERDEDLMELITKSFDLSNVIKVIQ
NGRRHSI
Download sequence
Identical sequences G1NNK4
ENSMGAP00000015231 XP_010719666.1.16129 ENSMGAP00000015231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]