SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015241 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015241
Domain Number 1 Region: 1145-1243
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-24
Family Pleckstrin-homology domain (PH domain) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015241   Gene: ENSMGAG00000014401   Transcript: ENSMGAT00000016190
Sequence length 1254
Comment pep:novel chromosome:UMD2:1:92732153:92788531:1 gene:ENSMGAG00000014401 transcript:ENSMGAT00000016190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEYSHTQNQMELQNASLGKGSVVNSLENGLQDIMENLNTKKYSSSLKFKTNGDCAGSYL
TLSQPMMAKPSPSTSVKNIHSVTKIQGGKLFPCESPYLPDKSFSVKHLSSLSATSPSLSG
YNLGRTDFDIHANRENEKALGHTDKFYYSKYSQKNKSYDNVYLPGMLDTKKISGSLLTMW
NGSSGSELMLSPVSNSGAASMPSSPKQGRRMNIEDGLALHAKPVKHRDVMMETLASRPRK
YSGGSLSHMGMYSRSLPRLHKSTESQLMPLSLPPRNSLGNIKRKKLGEKDLPQNALDADN
YLNFSSCSSGVLPHANSFSGNNPYVSSTLSVPASPRIAKKMLLASSSSYIPDDFDRLGLS
GTSPSSSFSPVDFDRSFSVRRNLSTSSMEFDDTDLESYRQTPNSLQTSVRERKNSISSIS
GREDLMDYHRRQREERLREQEMERLERQRLETILNLCAEYSKSDSDPAATTTVADVQKIN
KELEKLQLSDEDSVFEDSQTNLETQFRNHLKSSASDSDFSEPSNHSRSTASFLSSRGLRA
DEHFNENMKPSSLATPGFLKDSTESSYLSITPKIPECTSDDQRGQELTRLEEERIVILNN
LEELEQKIKDLNDQMDESSRELDMECALLDGEQKSETTELLKEKEILDHLNRKIAELERN
VIGEKAKEKLKLDAEREKLERLQELYSEQKTQLDNCPESMREQLQQQLKRDADLLDIESK
HFEDLEFQQLEHESRLDEEKENLTQQLLREVAEYQRSIVSRKEKISALKKQANHIVQQAQ
REQDHFVKEKNNLIMMLQREKENLCNLEKKYSTLSGGKGFPVSPNSLKEGYISVSEISEL
YGNSTNISPSTQPPTDADAXVPATKVFLPVTEESISWHFRNLEERKKQHRECMYMSDTLP
RKKTTPTVSPHFNSSTLGRSITSKGHLPLGQSNSCGSVLPHCLATMTKESESRRMHKGYN
HQRICENQRQKSPEFYSRTASESNVYLNSFHYPDRSYKDHAFDTLSLDSSDSMETSISAC
SPDNISSASTSNVARIEEMERLLKQAHAEKTRLLESREREMEAKKRALEEEKRRREQLEK
RLEEETSQRQKLIEKEVKIREKQRAQARPLTRYLPIRKEDFDLRSHIETAGHNIETCYHV
SLTEKTCRGFLIKMGGKIKTWKKRWFVFDRNKRTFTYYADKHETKLKGVIYFQAIEEVYY
DHLKNAYKSPNPLLTFSVKTHDRIYYMVAPTPEAMRIWMDVIVTGAEGYTHFML
Download sequence
Identical sequences G1NNL0
ENSMGAP00000015241 ENSMGAP00000015241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]