SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015948 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015948
Domain Number 1 Region: 197-365
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.76e-37
Family Dual specificity phosphatase-like 0.000013
Further Details:      
 
Domain Number 2 Region: 376-511
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.7e-36
Family PLC-like (P variant) 0.0024
Further Details:      
 
Domain Number 3 Region: 57-192
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000863
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015948   Gene: ENSMGAG00000015042   Transcript: ENSMGAT00000016914
Sequence length 512
Comment pep:novel chromosome:UMD2:1:171900908:171918151:-1 gene:ENSMGAG00000015042 transcript:ENSMGAT00000016914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTVRYEQGSELTEASSSPKANEPTIKIDDGRDEDNEEDSCSNTIRRKISPFVMSFGFRV
FGIVLIIVDIIVVIVDLAISEKKRGIREILEGVSLAIALFFLVDVLMRVFVEGFKNYFRS
KLNTLDALIVVGTLLINMTYSFSDLAATDQMPRMVTLLRVLRIVILIRIFRLASQKKQLE
VVTRRMVSENKRRYMKDGFDLDLTYVTDRVIAMSFPSSGKQSFYRNPIEEVARFLDTKHA
DHYKVYNLCSEKGYDPKYFHYRVERIFIDDHNVPALQDMLKFTTSVSEWMNQDEKNIIAI
HCKGGKGRTGTMVCIFFLNADFNFRLPQESLDYFGERRTDRTTSTKFQGVETPSQSRYVG
YYEILKNKYNFKLPPERQLKIKNLKIHSIHGVGKGNGTDMKVQIIMKKQVVLECACATQG
NCKLFFDSESDSVVIGLEDSPVISGDVKVRFESNSDLPKGYDNCPFFFWFNTSFIENNRL
YLPRNELDNPHKSKTWKVYSETFAVEMNFTEL
Download sequence
Identical sequences G1NQ81
ENSMGAP00000015948 ENSMGAP00000015948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]