SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000016029 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000016029
Domain Number 1 Region: 758-968
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.02e-59
Family DBL homology domain (DH-domain) 0.0000000436
Further Details:      
 
Domain Number 2 Region: 954-1106
Classification Level Classification E-value
Superfamily PH domain-like 8.31e-48
Family Pleckstrin-homology domain (PH domain) 0.00000138
Further Details:      
 
Domain Number 3 Region: 652-778
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-23
Family SH3-domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000016029   Gene: ENSMGAG00000015116   Transcript: ENSMGAT00000016997
Sequence length 1170
Comment pep:novel chromosome:UMD2:1:184878550:184917839:1 gene:ENSMGAG00000015116 transcript:ENSMGAT00000016997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSFKKLKSSVLQGIQARECPDILNENGVGKHNSNGAVVSVQTNRYSYSGPLQDFQSAVD
GLASDCSDAEESDESFLRNTHRSRSIRRAYGAGRINLLDTDKAQSHHNSTRPTSPVLTEP
KICEILVKDSENNRIIYRRSKSSDNLNFLKKSSFKRKSTSNLTDLKATNEKQMPARTVSV
TSADSDKTNGNPERRSKRWKSPIRAKDFDRVLKLVSNVTEVAWKKDGPKSTAPSPSEQSQ
RTRSNSRLHDDYSRRVSSSTDHDRKRCTSSVSSLDSSSPGTPCLQSPVAAQDKEAEMNVA
RAEDKNLRTSSGIAESDSLSPTLSDIGPFPNEVFDTDSDEPKAPQQFICDAEHPHVPVRP
TAPKPQSPSMEKVMCNMDFQCSNHHSTLSLSSTESEERGEVGPKLGRNPVCFQDAVQTVY
YDDGNEDSGISSHSQLSLNLASGAEEKKEEVVSDDHWKKSPPQDEEKTDTQRVTPRRWGS
GKRSRPRPLSDYGQMSIRSISIPEDAVAVESQKTDYTDGQNQPGLASVGSVIQSNTVGYS
RGRKRRPISVIGGVNFYGSGPAEEIEGLLTQPTTRPPVPAHQVPPYKAVSARFRPLTFSQ
STPIGLDRVGRRRQMRTSNAAADGGTESSALVDDNGSEEDYSYEELCQATPRYLQPGGEQ
LAINELISDGSIVYAEALWDHVTMDDQELGFKAGDVIRVLEASNKDWWWGRNEDKEAWFP
ASFVRLRVNQEELPENCNSIQDEEQDADISKHRQKIAENKDQMRTNVIQEIMNTERVYIK
HLKDICEGYIRQCRKHTGMFTTAQLSTIFGNIEDIYKFQRKFLKDLEKQYNKEEPHLSEI
GSCFLQHQEGFAIYSEYCNNHPSACIELSKLMKQGKYRHFFEACRLLQQMIDIAIDGFLL
TPVQKICKYPLQLAELLKYTTQEHSDYNNIKAAYEAMKNVACLINERKRRLESIDKIARW
QVSIVDWEGPDVLARSSELIHSGELTKISKQGKSQQRTFFLFDHQLVFCKKDLLRRDILY
YKDRIDMDEMELVDTEDGRDKDFNINVKNAFKIINRATEEVHLFCAKKQEDKKRWMEACE
SERRRVREDKEMGMEISENQKKQAMQNARKSRHGKIKGVSYNGCPVPPLHQSLHPIHQRH
ITVPTSIPQQXKRKPSLFWHTFNKLTPFKK
Download sequence
Identical sequences G1NQE5
ENSMGAP00000016029 ENSMGAP00000016029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]