SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017753 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017753
Domain Number 1 Region: 185-302
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-36
Family Third domain of FERM 0.00023
Further Details:      
 
Domain Number 2 Region: 84-184
Classification Level Classification E-value
Superfamily Second domain of FERM 2.36e-28
Family Second domain of FERM 0.0000967
Further Details:      
 
Domain Number 3 Region: 9-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.23e-20
Family First domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017753   Gene: ENSMGAG00000017087   Transcript: ENSMGAT00000018663
Sequence length 311
Comment pep:novel chromosome:UMD2:1:150643433:150662515:1 gene:ENSMGAG00000017087 transcript:ENSMGAT00000018663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCYLVVGYCSFSSFVFFLQQRAPGKVLHDAVCNHLNLVEGDYFGLEFPDHKKMMVWLDLL
KPVMKQIRRPKHVVVKFVVKFFPPDHAQLQEELTRYLFALQVKQDLAQGRLTCNDTSTAL
LISHIVQSEIGDFDETIDREHLAKNKYIPQQEALEDKIMEFHRNHMGQTPAESDFQLLEI
ARRLEMYGIRLHPAKDREGTKINLAVANTGILVFQGHTKINAFNWAKVRKLSFKRKRFLI
KLRPDVNSSFQDTLEFLMASRDFCKSFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFR
FRYQSKDLHFH
Download sequence
Identical sequences G3UQ83
ENSMGAP00000017753 ENSMGAP00000017753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]