SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019081 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019081
Domain Number 1 Region: 503-622
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 1.28e-41
Family Phosphoglucomutase, C-terminal domain 0.00000131
Further Details:      
 
Domain Number 2 Region: 370-502
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 4.32e-36
Family Phosphoglucomutase, first 3 domains 0.00000284
Further Details:      
 
Domain Number 3 Region: 272-385
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 5.1e-32
Family Phosphoglucomutase, first 3 domains 0.000000698
Further Details:      
 
Domain Number 4 Region: 163-304
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 8.63e-29
Family Phosphoglucomutase, first 3 domains 0.00000781
Further Details:      
 
Domain Number 5 Region: 56-162
Classification Level Classification E-value
Superfamily EF-hand 2.24e-18
Family Calmodulin-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019081   Gene: ENSMGAG00000011767   Transcript: ENSMGAT00000019465
Sequence length 633
Comment pep:known chromosome:UMD2:10:28928725:28975016:1 gene:ENSMGAG00000011767 transcript:ENSMGAT00000019465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSPGSNAALADQKGTHSEGSQAKQSQHAEEAIFYKNCRAAYLTVFKSSLENIKSKEQL
TLVLQQAGRNPSQKTVNKYWTSQTTTLNFDDFCTILKEETPAARTELLEAFGKIDTDNTG
YILHDELYKLLTTEGEKMTLDEVNAITKLPDFNCSGKLDYKKIGRLVIGQNGILSTPAVS
CIIRKIKAIGGIILTASHNPGGPNGDFGIKFNTANGGPAPEGITDKIFQISKKIEEYAIC
PDLKVDLGTIGKQQFDLENKFKPFTVEIVDSVEAYANMLRNIFDFNALKELLSGKNHLKI
RIDAMHGAVVGPYVKKILCEELGAPANSAVNCTPLEDFGGHHPDPNLTYAADLVQTMKTG
EYDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAANILSIPYFQQTGVRGFARSMPTSG
ALDRVAHATKIALYETPTGWKFFGNLMDANKLSLCGEESFGTGSDHIREKDGLWAVLAWL
SILAARKQSVEDIMKDHWHKYGRNFFTRYDYEEVDADAAGKMMKDLETVMFDRSFVGKQL
SAGDKVYTVEKADNFEYHDPVDGSVSRNQGLRLIFSDGSRIIFRLSGTGSAGATVRLYID
SYEKDAKKIHEDPQVGVKSLLKSMDLCLVLLCL
Download sequence
Identical sequences G5E7P4
ENSMGAP00000019081 ENSMGAP00000019081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]