SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019442 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019442
Domain Number 1 Region: 203-270
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000101
Family DEATH domain, DD 0.011
Further Details:      
 
Domain Number 2 Region: 99-156
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000294
Family TNF receptor-like 0.0037
Further Details:      
 
Domain Number 3 Region: 25-77
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000228
Family TNF receptor-like 0.0023
Further Details:      
 
Domain Number 4 Region: 288-363
Classification Level Classification E-value
Superfamily DEATH domain 0.00000074
Family DEATH domain, DD 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019442   Gene: ENSMGAG00000012502   Transcript: ENSMGAT00000018276
Sequence length 398
Comment pep:known chromosome:UMD2:3:86978198:86990168:-1 gene:ENSMGAG00000012502 transcript:ENSMGAT00000018276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCCTLLLLDISVKWSIQDISPPKYLHYDPGASRQVMCNQCPPGSYVKQHCTASSPTVCAP
CPDQYYAEDWNSNDECQYCSAVCKELQYIKQECTSTQDRVCECIEGWYLELEFCLKHTEC
PPGFGVAQPGTPESDTVCKRCPEGFFSNETSSKAVCQKHTNCSALGFKTALKGNAVRDNI
CQENTDTSPQKCGIDVTLCEEAMFRFAVPTHLTPNWLNTLADNLPGTKISTENIERIKQR
HSSQEQTFQVLKLWKQQNKEQDTVKKIIQXXXXXXNSVLKHLGQPNLTFEHLNTLMASLP
GKKVGKEDIERTMKLCQHAEQVLKLLNLWRIKNGDQDTIKGLMYGLKHLKTYHFPKRIIQ
SLKKVIKFLHRFPMYRLYQKLFLEMVGNQLKSVKVRCV
Download sequence
Identical sequences G3UUH8
ENSMGAP00000019442 ENSMGAP00000019442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]