SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|478181596|ref|YP_007702666.1| from Octadecabacter antarcticus 307

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|478181596|ref|YP_007702666.1|
Domain Number - Region: 3-78
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0403
Family NQO2-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478181596|ref|YP_007702666.1|
Sequence length 122
Comment putative DUF1636 family protein [Octadecabacter antarcticus 307]
Sequence
MTTWITICDTCKCAGWEVTGMEKTDGEALAELIEAAASGATDVKTRRVSCTMGCDRACNI
TVQANGKINYSLGTFEATKSDAQAIVEYAGKHAASANGQVPYREWPQGVKGHFVSRHQPL
PE
Download sequence
Identical sequences M9R1C1
WP_015498090.1.44912 gi|478181596|ref|YP_007702666.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]