SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|478182233|ref|YP_007703303.1| from Octadecabacter antarcticus 307

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|478182233|ref|YP_007703303.1|
Domain Number - Region: 5-94
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0291
Family Thioredoxin-like 2Fe-2S ferredoxin 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478182233|ref|YP_007703303.1|
Sequence length 135
Comment hypothetical protein DUF1636 [Octadecabacter antarcticus 307]
Sequence
MNTHHTHKITVCTSCKHKGTECRPGFELIEKLRVAITAAGDAIPADSEVSGVACMAGCDR
PCTVAYHGSRKATYLFGDIDPAEDIDDLVTFARQYNNLDDGWCSSVDRPGKLRKSTLARV
PAAMIATQASAVRAS
Download sequence
Identical sequences M9R204
gi|478182233|ref|YP_007703303.1| WP_015498712.1.44912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]