SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|478182821|ref|YP_007703891.1| from Octadecabacter antarcticus 307

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478182821|ref|YP_007703891.1|
Domain Number 1 Region: 1-39
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000132
Family Thioltransferase 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478182821|ref|YP_007703891.1|
Sequence length 42
Comment hypothetical protein OAN307_c15840 [Octadecabacter antarcticus 307]
Sequence
MILYGLPTCSDCNRARKDLANAGHDLAFCDVRADLISEDKWL
Download sequence
Identical sequences M9R4W5
gi|478182821|ref|YP_007703891.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]