SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|478183367|ref|YP_007704437.1| from Octadecabacter antarcticus 307

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478183367|ref|YP_007704437.1|
Domain Number 1 Region: 52-172
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.67e-31
Family Glutathione peroxidase-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478183367|ref|YP_007704437.1|
Sequence length 177
Comment thiol:disulfide interchange protein dsbE-like protein [Octadecabacter antarcticus 307]
Sequence
MSKLMMVPVVLFAALAGLFAAGMYSSQGPELPSAFIGRPAPAIDVSDIVGLAPLTDAMLR
DGEVKIVNFWASWCAPCRVEHPSLTALADEGVPIYGINYKDLDRNALSFLGELGDPYLAV
GSDPRGFHAIDWGVYGVPETFLIDGDGTILLRMAAPVTQRELANRLRPALDAARAAN
Download sequence
Identical sequences M9R7R1
gi|478183367|ref|YP_007704437.1| WP_015499826.1.44912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]