SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|478183590|ref|YP_007704660.1| from Octadecabacter antarcticus 307

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478183590|ref|YP_007704660.1|
Domain Number 1 Region: 2-208
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.69e-48
Family Thioltransferase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478183590|ref|YP_007704660.1|
Sequence length 214
Comment putative DSBA-like thioredoxin family protein [Octadecabacter antarcticus 307]
Sequence
MVKLDIISDPICPWCYIGKTNLDRALEQIPDHPFTIEWHPFQLNPTMPAEGMDRRAYLEG
KFGGKNAAVKAYAPVMQAAEAAGLKIDFEGMKRTPNTINAHRLIHWAGIEGRQTFVVHRL
FEAYFRDARDIGDSHVLADIADSCEMDASLVSKLLASDADIADIQKRDAHSREMGISSVP
TFIVANQHAVPGAQSAEMWLKVMGEIIDQIEAAE
Download sequence
Identical sequences M9RCA8
gi|478183590|ref|YP_007704660.1| WP_015500044.1.44912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]