SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|478184040|ref|YP_007705110.1| from Octadecabacter antarcticus 307

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478184040|ref|YP_007705110.1|
Domain Number 1 Region: 12-73
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000166
Family Thioltransferase 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478184040|ref|YP_007705110.1|
Sequence length 90
Comment hypothetical protein OAN307_c29190 [Octadecabacter antarcticus 307]
Sequence
MVFGTDADLAIDLTIYMTPTCPDCHALKAWLDREGIPYDERDLTDQAIMEDAMARYGVRV
APITVGDGWFAYGPFTKQKPEIEAALRERV
Download sequence
Identical sequences M9RDM7
WP_015500470.1.44912 gi|478184040|ref|YP_007705110.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]