SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|478185731|ref|YP_007706801.1| from Octadecabacter antarcticus 307

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478185731|ref|YP_007706801.1|
Domain Number 1 Region: 44-203
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.12e-43
Family Glutathione peroxidase-like 0.0000709
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478185731|ref|YP_007706801.1|
Sequence length 205
Comment protein SenC [Octadecabacter antarcticus 307]
Sequence
MSKTYVVAAGAVVVALLGGTILATQFGGNDDAFAQCRASQSAGGAIGGPFELVDENGVTV
TDTDVITGPTLIYFGFTFCPDVCPLDNMRNAQAVDILDAQGIEVTPVFISIDPERDTVDV
VREFTNNFHERMIGLTGSLEQVRAASQAYRTYYAKQESEDDFYLVDHTTMSYLVFPEQGF
QEFYRRDVTAEQMAESLSCFIEAAS
Download sequence
Identical sequences M9RDA5
WP_015502052.1.44912 gi|478185731|ref|YP_007706801.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]