SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|478181449|ref|YP_007702519.1| from Octadecabacter antarcticus 307

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478181449|ref|YP_007702519.1|
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000275
Family Glutathione S-transferase (GST), N-terminal domain 0.0088
Further Details:      
 
Domain Number 2 Region: 73-196
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000141
Family Glutathione S-transferase (GST), C-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478181449|ref|YP_007702519.1|
Sequence length 198
Comment glutathione S-transferase-like protein [Octadecabacter antarcticus 307]
Sequence
MKLIMSPPSPFARKARVLLRETGLIDRVEEIEISSSPLASDAQILAANPTGKIPALIRED
GPAIYDSRVITRYLDDMADAGLYPVTSLYEVLTLEATADTIMDVTVAMTYDARFRPDQKS
PEWTEAQWGKAARAIAAINNRWMSHLSGPLNMAQIAVSCALSYVDLRHDARNWRHGNDAL
ATWQAEFEARGAMQATKP
Download sequence
Identical sequences M9R7Z4
WP_015497946.1.44912 gi|478181449|ref|YP_007702519.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]