SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|478181715|ref|YP_007702785.1| from Octadecabacter antarcticus 307

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478181715|ref|YP_007702785.1|
Domain Number 1 Region: 101-224
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 7.38e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.0013
Further Details:      
 
Domain Number 2 Region: 10-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.16e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478181715|ref|YP_007702785.1|
Sequence length 232
Comment putative GST-like protein [Octadecabacter antarcticus 307]
Sequence
MADLSNFPITQKWVPQNTDIIQLFSYPTPNGVKASIALEEMGLAYEPHLVTLSDADVKSA
EFLSLNPNNKIPAIIDPNGPDGPIGLWESGAILIYLAEKTGKLIGSNAAEKAHVIKWLMF
QMGGLGPMFGQLGYFSKFAGSEIEDPRPRERYVAEAKRLLAVLETELAGKDWIAGSFSIA
DIAIAPWLNALEFYGTQEITGYNDLTNVPAYVARFMARPAVQKGKTIPSREG
Download sequence
Identical sequences M9R740
WP_015498205.1.44912 gi|478181715|ref|YP_007702785.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]