SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|478184427|ref|YP_007705497.1| from Octadecabacter antarcticus 307

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478184427|ref|YP_007705497.1|
Domain Number 1 Region: 77-196
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.02e-20
Family Glutathione S-transferase (GST), C-terminal domain 0.0035
Further Details:      
 
Domain Number 2 Region: 1-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.24e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478184427|ref|YP_007705497.1|
Sequence length 201
Comment putative glutathione S-transferase [Octadecabacter antarcticus 307]
Sequence
MLTLFAAKGTVAVAPHIALEETGLAYEIKWISFANNDQRAPNYLAINPKGRVPALVVVHG
VLTEAPAILDYIAEITGQLMPEDIFARAKVREMIGYLAATMHINHAHGVRGARWSDDAAA
HASMVAKVPETMAASCAYVETCLPDAGWLVGDYTIADIHLYNVSRWLAGDGVEIADYPKL
AAHFASMQARPAVAKVAVLHG
Download sequence
Identical sequences M9RAQ5
WP_015500840.1.44912 gi|478184427|ref|YP_007705497.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]