SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|478184896|ref|YP_007705966.1| from Octadecabacter antarcticus 307

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478184896|ref|YP_007705966.1|
Domain Number 1 Region: 88-205
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000000000987
Family Glutathione S-transferase (GST), C-terminal domain 0.019
Further Details:      
 
Domain Number 2 Region: 35-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000359
Family Glutathione S-transferase (GST), N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478184896|ref|YP_007705966.1|
Sequence length 229
Comment putative gluthatione S-transferase [Octadecabacter antarcticus 307]
Sequence
MLYQLILGNRLYFSWSIAAYLMVEKFDLSDHFDIKIVHPEAEADVARFLKDIPPARTLPT
MITPEGVVVSDSSAIAEELSSRFPDAQMWPSNPAARAMARTVAAEMHSSFGGLRGGWPVN
LRHTFQGAVAPPNIERELDRLETIWANARAKTCADGPWLCGAYSLADAIFAPMASRLATY
KFDTRPVTKSYVAAHLGDPAFRKWRADGLANDPVMPKFDLDLPFDDWPN
Download sequence
Identical sequences M9RAU1
WP_015501273.1.44912 gi|478184896|ref|YP_007705966.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]