SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336177591|ref|YP_004582966.1| from Frankia symbiont of Datisca glomerata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336177591|ref|YP_004582966.1|
Domain Number 1 Region: 103-231
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.62e-16
Family GntR ligand-binding domain-like 0.017
Further Details:      
 
Domain Number 2 Region: 9-83
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000755
Family GntR-like transcriptional regulators 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336177591|ref|YP_004582966.1|
Sequence length 258
Comment GntR family transcriptional regulator [Frankia symbiont of Datisca glomerata]
Sequence
MARRRPDSAARKSRAEQVAADIEDEILEVRLPVGAHLGRRAEFMERFGISPTVMNETLRI
LRNRGLVGVRPGAGGGIFVASLPPQVRLGAMDLWFHDSGTHPLQLFEARMHLEAGLAAVA
FDRATAGDVDAIQDAYDRMASARDARSYVKGTMRMHRALVTAARIPVLDGMHQSVMALLE
ATLSRATFIDGHEPMLRHSLNVHSDIIEAIRTRNRFAFERAMKLHNDDLIRTNDPHRSPD
IRKISAVGTRAPMAKMTG
Download sequence
Identical sequences F8B3F3
gi|336177591|ref|YP_004582966.1| WP_013873008.1.39566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]