SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336178367|ref|YP_004583742.1| from Frankia symbiont of Datisca glomerata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336178367|ref|YP_004583742.1|
Domain Number 1 Region: 80-144
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000628
Family NfeD domain-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336178367|ref|YP_004583742.1|
Sequence length 147
Comment hypothetical protein [Frankia symbiont of Datisca glomerata]
Sequence
MVMQPWLWWLVIAGVLGVGEMLTLALILGMTALAALVAGAVAGVGGPLSVQLVAFAATSV
VLLLGLRPVARRHLHQAPATATGTDALIGVTGVVLEPVNGDGDGRVRIRGEIWSARATID
GQVLEPGTSVRVLRIDGATAIVHPAQL
Download sequence
Identical sequences F8B1E9
gi|336178367|ref|YP_004583742.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]