SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336179458|ref|YP_004584833.1| from Frankia symbiont of Datisca glomerata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336179458|ref|YP_004584833.1|
Domain Number 1 Region: 12-153
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.83e-47
Family Ribonuclease PH domain 1-like 0.000000328
Further Details:      
 
Domain Number 2 Region: 323-514
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-43
Family Ribonuclease PH domain 1-like 0.00000084
Further Details:      
 
Domain Number 3 Region: 154-264
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.8e-25
Family Ribonuclease PH domain 2-like 0.00000977
Further Details:      
 
Domain Number 4 Region: 477-572
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.13e-22
Family Ribonuclease PH domain 2-like 0.00002
Further Details:      
 
Domain Number 5 Region: 575-687
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.53e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Domain Number 6 Region: 268-347
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000154
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000396
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336179458|ref|YP_004584833.1|
Sequence length 733
Comment polyribonucleotide nucleotidyltransferase [Frankia symbiont of Datisca glomerata]
Sequence
MVPVEDQTISAEAVIDNGAAGQRTVRFETGRLARQAAGSAVAYLGDTMVLSATTVSKQPK
EQLDFFPLTVDVEERMYAAGRIPGSFFRREGRPSEDAILTCRLIDRPLRPSFVKGLRNEI
QIVATVLALDPDTLYDVVAINAASASTTLAGLPFSGPIGATRVGYVDGTWIAFPTHAELE
RATFDMVVAGRVLDDGSDVAIMMVEAEATAHTIPLLAAGSPAPTEDVVAAGLEAAKPAIR
ELCRAQRGLAERAAKPTRDFPLFIDYHDDVLEALSIAVGDELAAALRIAGKQEREAELDR
VRLLAAEKVVGQFEGREKEIGAAYRALTKKLVRQRIVADGVRIDGRGVTEIRELAAEVDF
IPRVHGSALFERGETQILGVTTLAMLRMEQTVDTLNPDRTKRYMHNYNFPPYSTGETGRV
GSPKRREIGHGALAERALLPVLPSREEFPYAIRQVSEALGSNGSTSMGSVCASTLSLLNA
GVPLKAAVAGIAMGLIREGDQFVTLTDILGAEDAYGDMDFKVAGTREFVTALQLDTKLDG
IPATVLAGALQQARAARLAILDVMAEAIDGPDEMSTHAPRVISVKIPVDKIGEVIGPKGK
MINQIQADSGAEITVEDDGTIYIGAQDGVSAESARSAINAIANPQLPEVGERYLGTIVKI
TIFGAFVSLTPGKDGLLHISKLKQLSGGKRVEKVEEVVQVGQKLQVEITDIDSRGKISLS
PVVEDADGVPVGA
Download sequence
Identical sequences F8B3B0
WP_013874794.1.39566 gi|336179458|ref|YP_004584833.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]