SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407473762|ref|YP_006788162.1| from Clostridium acidurici 9a

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|407473762|ref|YP_006788162.1|
Domain Number - Region: 48-100
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0915
Family Occludin/ELL domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407473762|ref|YP_006788162.1|
Sequence length 246
Comment hypothetical protein Curi_c13040 [Clostridium acidurici 9a]
Sequence
MNNNIKNKIAMTTVCIILGIILTIQFKTVDGLNTNILSTQRSQQIAVEYKKLKNEKEKIL
KEMELLEKKVSQYEKGEAGKDDFLENLYKDIEKYKMLSGYEDVSGPGVTLQIDEPPAEIQ
VGDQRNTIVEHYGALLEIISLLNAVEAEAISINDQRYTAFTEIVPAGNLLEINGMSFGTP
IVIKVIGDPEDIENALRIKGGIIWLMEEGYNLQIHIKQEKDIFIPKYKKVKEFKNAKPAI
VNANNP
Download sequence
Identical sequences K0B020
gi|407473762|ref|YP_006788162.1| WP_014967452.1.44507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]