SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr10_P30629 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr10_P30629
Domain Number 1 Region: 591-891,926-998
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 9.68e-88
Family Oxysterol-binding protein 0.0017
Further Details:      
 
Domain Number 2 Region: 315-408
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-18
Family Pleckstrin-homology domain (PH domain) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr10_P30629
Sequence length 1220
Comment oxysterol-binding protein 1c-like
Sequence
MEVEDSRPQEEENEAVNDITGPPILTHLIDDRSCQTSRLHRIGGDRIMEAGKAKQQQQRE
RRTSNGIIIKLYEEAPPTPGANRPIQRRSRLGAPSLLAYDRRKMLLAYSQQLRQCHEQQT
QRCCKIVPRPSWGQWKAAFLRNHGGKILARRGILAVLRKLKSLGLCASGSLCVVGERWSD
VSVYACPAFCQIALLAQLLSLDCSICALKKMKPQGFNHPMTTYFAGDYLNKSKGKSNIAG
LLDSEGRCFRASTFDSLHFGKKKMQGTVHVRMRVRGDLKGKSPEILASASLRSSFHDAPL
EHREVRLNNIVGNGIAGILHKWVNYGKGWRPRWFVLQDGVLSYYKIHGPDRIEVSQESEK
GSKVSSIRESRSDDKRFSIFTGTRRLHLRAETREDRVAWMESLQAVKDMFPRNSNGEFTG
SVDKVVVSTDKLRQRLQEEGNQLMLLKQNQNLLVDHLGQLETEKVDLENTVVDEGQRQSR
QSKEYGSAARSRQEKYSEESASESDYDNEKPDAAEEETDEEDNAFFDTRDFLSSSSFKST
ESDFHRSEFDSDDENDHGVDSVGSSDSSMQYVGCNYPYVKRRKKLPDPIEKEKGVSLWSM
IKDNIGKDLTKVCLPVYFNEPLSSLQKCFEDLEYSYLVDRAYEYGKKGNGLMRMLNVAAF
AVSGYASTDGRTCKPFNPLLGETYEADYPDKGLRFFSEKILVCACMFVKVSGKGGPMHKA
PINAGSGIVFTLNYTCYNFVLVSAWIIRSVIIPWLLHVIVRVDPVGVLTLEFDDGEVFQW
SKVTTSIYNLILGKLYCDHYGTMRIQGNREYSCKLKFKEQSIIDRNPHQVQGIVQDRSGK
TMATLIGKWDESMHYVNGDCSGKGKGSDPFSEAHILWKRSKPPKYPTRYNLTRFAMTMNE
LTPGLQVRSFYLLLSLFSFTQIVEQEKLPPTDSRLRPDQRCLENGEFEMANSEKLRLEQR
QRQARKMQERGWKPRWFAKDKGSDMYRLKLCYTEPGGHSTPFRGQRLEILHHCLAFYDDI
YRRNEQEKVKAGGRIRQRNKCCIKFNWEKNHIYNLSILLAESAVRAREESCLVQRPSLSS
IPFPMLPLSCNATSRKCKPTQVRPIAGVNVPRPVGSLLLVLRDNSAQGTTTCCLVPDDLA
LGLTYDDNVCTLCLHVHEQIPRSRSGFTSGEVEWGDTEQKLKATFQWAHHLTWVNHEGDR
LTSDGDPRFLVYSFIVMLKV
Download sequence
Identical sequences ITC1587_Bchr10_P30629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]