SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr11_P31976 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr11_P31976
Domain Number 1 Region: 178-323
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000143
Family Ran-binding domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr11_P31976
Sequence length 327
Comment 1 domain containing expressed
Sequence
MDAPSFGVHRVESSHQHLMAGPTLDPQRAESAHRHVRALNSQFASWVQLQLQSHPDELWE
DGVSDYLSHASHIMENFKDVVDWLKAKSAKQKSSSSSQKSLFTVSESNKATDVTNGVVKQ
MTPASFPSFHDSGSQSSGLFSFSQKPAFSGMQGDATKVEVSGDVDDEEDDQKKPSSPSLE
KAEEKGIIVVHEAKCKVYVKPDDPADKAWKDMGVGHLSIKCKEGVEKATKDSRPTIVIRN
DEGMRKNFPHDKGPQVGKILVNALIYHGIKMNIQKNTITSIFHTAGGAHGAGADSKDIVA
RTYLLRLKNQEETTKLATAIKDHTPSD
Download sequence
Identical sequences ITC1587_Bchr11_P31976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]