SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr4_P10172 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr4_P10172
Domain Number 1 Region: 165-315
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.66e-36
Family Retroviral integrase, catalytic domain 0.0059
Further Details:      
 
Domain Number 2 Region: 592-718
Classification Level Classification E-value
Superfamily At5g01610-like 5.75e-36
Family At5g01610-like 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr4_P10172
Sequence length 746
Comment hypothetical retrotransposon
Sequence
MKKECRFWKREQNEMKKNEKETNTIAAESNITIVVIDSSASFHVTSHGDFFRSYTAGDFG
NVRMGNNGTSKIVGIGDICLETSIGSKLILKDVRHVPNIRLNLISTGRLDDEGFTHYFGE
RKKLNSFYILEAKLHKEEINATQRLGHISEKRLQTLARKQFLPELHVHTDVCTMQTGTLG
CALYFVTFIDDHSRKMWAFALKSKDQVLDVFKEFHVSVERETGRKLKYIRSDNGGEYMGP
FENYYKFHGIRLKKTVPKTPQQNGVAERMNRTIEERIRCMLSHAKLPKSFWGEAMRTTVD
LINLSPLVPLKGDIPERFMMIMGEMNKKIVVRMLVMILPPPPPVEIPLRRSTRERQPSTR
YPLHEYVMLTDRGELETYQEAILHEHKNEWVKAIQEEMRSLLENHTYDLVKLPKEKKSLK
NKWVYKLKIENNRRNKFSDDDFIILLLYVDDMLIIGHDIEKIGKLKRELSHFKLSSKQCP
TSKKEKEEMSKVPYSSAVDSLMYVMSSNFHELLSTWYVKKPLQKDPHISILDDSLSGVKL
EIQIRKAPRTTSNYLLRGESGIRSCEALFPSRRPKTSHGDLPPRPPPPLLLLHLLHFSAS
ASSGVHDVLKDHGLPKGLIPHSARDYSLADDGQFVVHLKAPCYVQFSDLVYYDQTITGKL
SYGAITDLDGIQVKKLFVWFPVSAVKAHPESKTIEFKVGFLSQSFPLKEFKDVPDCEKKT
RASCRGATGFSPEELLPVTAVQQPFL
Download sequence
Identical sequences ITC1587_Bchr4_P10172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]