SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr5_P12135 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr5_P12135
Domain Number 1 Region: 199-251
Classification Level Classification E-value
Superfamily At5g01610-like 0.0000575
Family At5g01610-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr5_P12135
Sequence length 608
Comment hypothetical protein SORBIDRAFT_04g027520
Sequence
MVGNAMVGDVVACSFELVSWIYRMSLASSRAHATMSPTIAIPTTANDTCSDLDEYYFYCE
STYHSFHLLSGFQTPGWVRPSTFASGAAARRLPKVGSTGVQMQDDVALASRRRMRGKGEG
GGEEVDEGEEDEEAEDGVDEEGENQVVPWSMTPPPVASSSSSRGVTPYFLPQHPNKTQEN
KKQAAIFIEKSGAKPGNMFLPHLITSLHLSTTAAPGAYEVLRSHGLPIALLLKGVREFEV
DGGARFRARLDAPSAPPSSRASFHTLKVWVPTLFPKVYRWELLTQKLLALRSYNRSEEEG
NRRSSQMADGGDCKAQNGTFMETLNDAAAFFLPSKLLHSLSDVLPFLQYPGGGQLLRLLR
RFLLSAFHILLYLLSFLLFHLPSPPHPPPPHPLAASGFAVAPLADGSRAGRGLSRVLFAV
AHVPVASRKYDFVRSLAERILDDNLRATGGADLQTLNRTALAAAFARTLHGLEEALAAEA
ASANGVRSGGRIMGVLKSRVRAWAAGRVVPPAGEEGAGGSAEKLAAEAMWLGQKMAENGA
AAEAVAMWGTASRLAALAVVAEPRLQVAIVRLLCLAIGSSYGAHQGSACGSNAASNDGQW
CRRPNTKQ
Download sequence
Identical sequences ITC1587_Bchr5_P12135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]