SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr5_P13365 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr5_P13365
Domain Number 1 Region: 17-159
Classification Level Classification E-value
Superfamily At5g01610-like 3.27e-38
Family At5g01610-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr5_P13365
Sequence length 167
Comment Os11g0241200
Sequence
MDSPSKSYLFGVPIRKTLFGFILLLSLAPSSVETQISDEPTAYQMLEQYDFPRGILLQGV
RRYVLNQDGSFEVYLSGDCEFKITGGYLLHYKRKITGTVASGSLTNLRGDSVKVLFLWFG
IDEVVRSSDEIEFYVGSLSASFGLSNFEECPRCRCGFDCSAAMVSDS
Download sequence
Identical sequences ITC1587_Bchr5_P13365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]