SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr7_P18741 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr7_P18741
Domain Number 1 Region: 187-295
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.19e-19
Family Voltage-gated potassium channels 0.0032
Further Details:      
 
Domain Number 2 Region: 74-157
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.06e-19
Family Voltage-gated potassium channels 0.0019
Further Details:      
 
Weak hits

Sequence:  ITC1587_Bchr7_P18741
Domain Number - Region: 344-411
Classification Level Classification E-value
Superfamily EF-hand 0.0025
Family Calmodulin-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr7_P18741
Sequence length 411
Comment outward rectifying potassium channel
Sequence
MEEAAQPLLSSHRIHSEIEEYIPSSFSPSSDAATPPRLKSGLHRASTAPAMSAIPWDLFL
QDSEPNLDTSSPILKHASVLLLLYLFLGMLAYFFNPQGFSVVQTHPAVDALYFCIVTLCT
IGYGDITPVTPVTKAIACVSVLVGFGLINVLLTDAVNHLLNLQESAIIDSVRGASTRHTS
YIVDAEKGRMRIRTKVGLAVGAVVLSIGVGTLVLRLLENLDWTDAVYLSVMSVTTVGYGD
RSFKTTRGRIFASLWLLVSTLAVGKAFLYLVEARIDRRHRRIAKWILKRDLTVKDLLAAD
LNQKGFIRHHDLGVERFESVIYKLQITLTLAFMFCAEYKLMLTDCMTANKVYMALCSIFL
DFSKSEFVIHKLKEMGRIDEKEILSICNQFNKIDLHNTGKITLPDLLSVSR
Download sequence
Identical sequences ITC1587_Bchr7_P18741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]