SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr7_P19614 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr7_P19614
Domain Number 1 Region: 916-1164
Classification Level Classification E-value
Superfamily HAD-like 4.66e-46
Family Trehalose-phosphatase 0.0013
Further Details:      
 
Domain Number 2 Region: 539-645
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.08e-17
Family Anti-sigma factor antagonist SpoIIaa 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr7_P19614
Sequence length 1319
Comment sulfate transporter
Sequence
MMVHSVSDGVGDMHLKTDSLSSTDGQTENYQSVYKVGLPPRRNFIREFADAVKETLFSDD
PLRPYKDQPKSRKLLLGLQFLFPVLEWGRYYNLSKFKGDVIAGLTIASLCIPQDIGYAKL
ANMDPKYGLYSSFVPPLIYAVMGSSRDIAIGPVAVVSLLLGTLLQNEVDPLNDKEEYRRL
AFTATFFAGVTQATLGFLRQMLPLSLCILGFLIEFLSHAAIVGFMGGAAITIALQQLKGF
LGIKNFTKNTDIISVMKSVWGSVHHGWNWQTILIGTIFLAFLLFAKYIGKKRKSLFWVPA
IAPLISVVLSTLLVDLTRADKYGVQIVKKIDRGINPSSVGQIHFSGSYALKGFRIGVVAA
MIALTEAIAIGRTFAAMKDYQLDGNKEMVALGTMNIVGSMTSCYVATGSFSRSAVNFMAG
CKTTVSNMVMSLVVMLTLLLITPLFKYTPNAILSSIIISAVISLIDYEAAYLIWKVDKFD
FIACMGAFFGVVFVSVEIGLLVAVSISLAKILLQVTRPRTALLGNLPGTTIYRNMEQYPE
ATKVPGILIVRVDSAIYFTNSNYVKERILRWLRDEEEQLKANDLPQIDFLIVEMSPVTDI
DTSGVHAFEELYRSLRKHEVQLVLANPGPVVIEKLYSAKFPELIGHDKVLPTFHLKVIPS
RSHRSGRGQRLRHCHEIFHFLTKSDTLLFILSFTAKEGEEFLFPNLFVRPVAIQVVDLMP
ARSLRSFFVDQQTSMRKKNGLAMNSSLWLIAVGELLKAVNCTCLHVVVHVNVENECMHST
AYHRFKGGRDDEAEHGHAGAADALGRFRSSDHRIFISLLPSAASCHRCPAASYARFRKLL
SRTDLGGGGGGGAGRASSWIESMKALSPSQLSSAAARTAPVLASHGEDYDGWVKRHPSAL
HNFDELMAASKGKQIVMFLDYDGTLSPIVEDPDRAYMSDEMREAVRDAASLFPTAIVSGR
CREKVSSFVKLSELYYAGSHGMDIKGPNDGPKHTKAKAKAILFQPASEFLPMIDEVYKSL
VESTKSIPGSRVENNKFCLSVHFRCVDEKKWSLLDERVRTVLKDYPKLRLTPGRKVLEIR
PTIKWDKGKALEFLLESLGFDDCNDVMPLYIGDDRTDEDAFKVLRDRGQGYGILVSKIAK
ETSASFSLREPAEVLEFLCRLVEWKQFHADAAAFSHLPHGSSSADLWHSVRAMKGNEGHH
KVPLDGMKRRSWLRSWSPLQRSSSSGFANMRSLPAISCVERWGVQIIEGIAFTCLDSSSS
SEEGKADGRRRGGDEAVRDACFFRALTSPKFPFVNELWSMGHILPSGIAEHQKGLAYVQ
Download sequence
Identical sequences ITC1587_Bchr7_P19614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]