SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr8_P24715 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr8_P24715
Domain Number 1 Region: 444-649
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 2.65e-42
Family MPP-like 0.0000322
Further Details:      
 
Domain Number 2 Region: 661-876
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 2.33e-30
Family MPP-like 0.0000449
Further Details:      
 
Domain Number 3 Region: 83-166
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 6.67e-19
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr8_P24715
Sequence length 972
Comment mitochondrial-processing peptidase subunit alpha-like
Sequence
MDAEELRRMLRGSGVDLWALLETAVAVAAADHAEELRARRDGIVERLYAPPAPLQKEEKG
SSSPVMKTVHREEDEEDVEVNVEKRNVLAIKKSLEDADQRSEDSLVGLLQDLLDTDITFK
ALKETDIGRHVNVLRKHSSDEVRGLAKQVVRKWKDLVDGWVKSNSADLSIQLLISLPNCD
RLRNVEALRILSPCWIQADDYSSSERNTLETMEPKAKTSQKLLDPEKLASARRRLHENYR
EAQNVYTEHFSTCSEKMSRISDLATRVRARSYTSSRHPSVVRPLCDDDAASTKTNKHRRI
AFSKASRRWIVIDPRSTCYGSTFLACFARFPPRKLPPPQNPRLVTGVAKEGSLWFAAREK
CFDFRNDFVLISKHFKNGAIRKSGLTALTLHDGTSGHGVASRYLSHEPLSYSEDSYIKCI
PPLFHPLPGLKLPICLPDSAERNPTKVTTLPNGLRVASEDALGPAACVGIYVDSGSIYET
EESIGVTHLLERLAFKSTKHRSHLQIVHEVESTGGNVGASASREQMGYSYDTLKAYLPAA
VELLIDCVRNPVFLESEVQEQVKRIKWEIGDITKDPQQFLLDSLHLAGYSGALGKPLMAP
ESALERINGSMIGKFYQENYTADRMVLAAFGVDHEHLLAIADPLLCDIERGIAMDVPKST
YTGGDLRHKIYSEKTHVALAFEVPGGWRHEKDATALTVLQTLMGGGGSFSAGGPGKGMHS
RLYLRVLNKYQEVQSFLAFSSICNDTGLFGIHSITGSDFVAKAVDVAVNELHAIATPGQD
AGNSLRVILLFKHVFLVTELELHRAKNATRLAILLNLESRAIAAEDIGRQILTYGCRKPV
DYFLRCLDELTLDDLTILAQKMLSSPLTMASWGDVNYSVKNLAHNYTRLLQSIVFQVMLL
LPSDFRHPSNSKSSLLGGRFLMMEIDLADFAYFPNEKTRIISFSTRWCCFYLPVGGVVNL
IANIFDLIQNNL
Download sequence
Identical sequences ITC1587_Bchr8_P24715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]