SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ITC1587_Bchr9_P25252 from Musa balbisiana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ITC1587_Bchr9_P25252
Domain Number 1 Region: 429-755
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 8.63e-102
Family Oxysterol-binding protein 0.00092
Further Details:      
 
Domain Number 2 Region: 86-127,171-225
Classification Level Classification E-value
Superfamily PH domain-like 4.98e-19
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Weak hits

Sequence:  ITC1587_Bchr9_P25252
Domain Number - Region: 246-304
Classification Level Classification E-value
Superfamily Prefoldin 0.0902
Family Prefoldin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ITC1587_Bchr9_P25252
Sequence length 933
Comment oxysterol-binding protein 1d-like
Sequence
MNPLCCIAPVSLERGDRGDPSQVGTLKAAKPPLGAESPSRSLSSKKLIQAPTIPSDSDAA
ARREAADEAAAAAGLAEGGDAKSGSGNGAVAGVLWKWVNYGKGWRSRWFVLQDGVLSYYK
VHGPDRVSVGPAACKAGVRVIGEESLRRVRKEQQWESGSFVGWGAANQWKPFGEVHLKVT
SIRASKSDDKRLYIFTGTKTLHLRCDSREDRTAWIEALLSAKENFAHLLTINASEPSVEV
TVSTDKLRGRLAQEGLSESTVKECESIMLSEISELQNQFKSLQQKHLILLDTLRQLETEK
VELETTVIDETKEREAHFGLMNGRFSDFYSVISEGTATDSEADNESQGADAETDEDDGMY
FDTRDFLSSESLRSASYRSREVLGNCCTGSTCCTESYFPDNIQDISTGVRMIEYPYVKRR
NKLPEPKEKEKPVGLWSIIKENIGKDLSGVCLPVYFNEPLSSLQKCFEDLEHSYLVDRAL
EWGRQGNSLMRILHIAAFAVSGYASTEGRQCKPFNPLLGETYEADYPDKGLRFFSEKVSH
HPMIVACHCESRGWKFWGDSNLKGKFWGRSIQLDPIGILTLQFEDGETFQWTKVTTSIYN
IIIGKIYCDHYGTMRIRGSGHYSCKLKFKEQSIIDRNPHQVHGFVQDNRTGNKVAMLMGK
WDEAMYYVLGDPSTKPKGYDPMSEAVLLWEQDKSVTQTRYNLTPFAISLNELTPSLMEKL
PPTDSRLRPDQRHLENGEYELANAEKLRLEQLQRQILILFINDIKSNPRPRLQGKLKRQG
SGETLVHSKSSTNVEVGCDRAWVHGEGCVSICREPNLLTDWYFDSHLLTSATVLGQQCRE
ENVMVQNLQFPFFLRKDTTHPYTGLTSLCEDLVALSKLFPDTAAREFNTKKLRCPPLAEA
SLLGIETNHMTREVPSYYHRKDHQLMFFKIKSA
Download sequence
Identical sequences ITC1587_Bchr9_P25252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]