SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MhA1_Contig0.frz3.gene53 from Meloidogyne hapla

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MhA1_Contig0.frz3.gene53
Domain Number 1 Region: 27-83
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000366
Family Tachycitin 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MhA1_Contig0.frz3.gene53
Sequence length 105
Comment MhA1_Contig0.frz3.gene53 MhA1_Contig0.frz3.gene53
Sequence
MNHYLQVLASILLISQLYVVNCFNPLNCDPNTESLFVEDPTDRQAFFSCKPYANYPSIGF
WSRHYCPYGMHFEYSSQQCTTDSLPPNTVREANDLLQLGKAFNNF
Download sequence
Identical sequences A0A1I8AW36
MhA1_Contig0.frz3.gene53

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]