SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MhA1_Contig1243.frz3.gene9 from Meloidogyne hapla

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MhA1_Contig1243.frz3.gene9
Domain Number 1 Region: 452-497
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 2 Region: 283-313
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 3 Region: 365-407
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000034
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 194-230
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000563
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 152-190
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000123
Family LDL receptor-like module 0.0021
Further Details:      
 
Weak hits

Sequence:  MhA1_Contig1243.frz3.gene9
Domain Number - Region: 414-450
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000196
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number - Region: 233-273
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00038
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MhA1_Contig1243.frz3.gene9
Sequence length 541
Comment MhA1_Contig1243.frz3.gene9 MhA1_Contig1243.frz3.gene9
Sequence
MLYSNDSFLLGQTGIPLDFSEPHSGGDGSGDGRGRDGSCFNFGKVDDFRLWLSTRCCTCL
SFVPSLALVLIAAVLITLLVATIPLAFALIYSSPQATESAVQTSSIGNGDKFNFFVDRDH
SSWPELTEVLKYQDWEDHTSLRTTELLPKNISSCTIYGFACTAQPHIVVSQNRRCDGNPD
CEDASDEIDCQGTDCSVGEYRCKDIDMCIPTEAVCDGENHCPFGDDEQNCKECSGGAKIC
GDEKEGICLAKRFLCDGFVDCHFDGSDEKECDCASCSGQFSALCNGTNKMCISKISVCDG
RFDCPDGEDEVGCPGVCPLPKLLSSLKDEEVNNTNHILCSDGHFHDRTQACDGLLEACRF
SCEKCNPASAFQCSGVDSMSQECIHRSLVCDGKSDCLDGSDELDCNCKSHGMNECNQHTK
TKLPFRRCYSNSNKCDGYSDCMGGEDERKCSSCASGAFLCRSEGRCVPPMARCNGETDCL
DESDEMNCTCKECSRHSKQMYMCEAAQRCYPLNKVCTPYSVCTNATRMDKMFCAIRGHEY
F
Download sequence
Identical sequences A0A1I8B1D7
MhA1_Contig1243.frz3.gene9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]