SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MhA1_Contig1763.frz3.gene2 from Meloidogyne hapla

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MhA1_Contig1763.frz3.gene2
Domain Number 1 Region: 481-767
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-50
Family YWTD domain 0.00000215
Further Details:      
 
Domain Number 2 Region: 259-300
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000144
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 3 Region: 304-342
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 42-78
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000707
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 198-230
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000825
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 428-462
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000692
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 7 Region: 139-187
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000113
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 8 Region: 118-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000236
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MhA1_Contig1763.frz3.gene2
Sequence length 979
Comment MhA1_Contig1763.frz3.gene2 MhA1_Contig1763.frz3.gene2
Sequence
MFNRILHINMLLFIFILLVFENTVFGRDAQNPIPRINKKDDSCPKNMFLCTSTMSCIPRS
WVCDQEVDCKEGEDEKNCEDNIPQCKEDEYACRTTQNGVRTETLNPWLSHLGTVGLYSHS
CIPSKWRCDGEVDCLLKDDEEGCPQIKCDENHFECKGFDNALTSCIPKEWVCDGQTDCMD
MKDETNCTGKPKDKCDKQSEFTCDDGQCIYKNWHCDGDHDCKDGSDEKDCKEATCESAGK
FKVPDHSDEENCKSSEMQQHHTLNCTSNEFTCKNGAQCISKFWLCDGDDDCFDGSDELNC
QKGKCSVGQKACKDGRCLDENLWCDGTEDCQDGSDEKNCTSPIKLSPQTCDSDTEYTCSE
SPTRCIKLQDLCRGNSASNDCTKSVCKEKILLCKENDNACSCRNTGIGTGKVCHCLSGFQ
VKGGICTDINECDQLGTCDQICINKPGGYQCDCYPGYRLAVPSKNMDKPVPHKCRARGSD
PLLLLSNRAAIRQYDIVTNKYHPLINKLESAVALDYWHENKTLVWSDVSKEQIVICSGIH
GLGDLATFESINNACNGPNLTRITDDVTTPDGLAIDWVHGLIFWTDTGTDTINVYDLKTK
KRTVIISGDGLDEPRAIAVDPSAGLIFWTDWGENARIERAGMDGKNRMVKERSIYKKDVI
IKGNTIRWPNGLAVDILDKRIYWADAKTKQISSSDYWGNNIRTILHSHQYLRHPFSLAVF
EERLYWTDWDQEGVLSVNKFHGGEVKKLMSGVTGPMTVRVYHEQAQPKHENKCEYSNCEI
CLPKALYKGESKDRETPLKEFPFSCACERGFQIDIENSSLCVPLNPLGIIADAAGESFKH
IKDDGNVSMSTYFFGLLIICAALALLYTYQHRRPRHFAALHFDNPIYRRTVEADLDADLE
NVPDNSIGPISILHMAGNGSLNDSYRQQANTTPFQDPQSKLVLKVPVQKREESGAISSNS
INMNDVNEYGYEQPPAPKF
Download sequence
Identical sequences A0A1I8BBK4
MhA1_Contig1763.frz3.gene2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]