SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MhA1_Contig210.frz3.gene2 from Meloidogyne hapla

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MhA1_Contig210.frz3.gene2
Domain Number 1 Region: 221-253
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000367
Family LDL receptor-like module 0.0027
Further Details:      
 
Weak hits

Sequence:  MhA1_Contig210.frz3.gene2
Domain Number - Region: 129-210
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00174
Family ATP-dependent protease Lon (La), catalytic domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MhA1_Contig210.frz3.gene2
Sequence length 279
Comment MhA1_Contig210.frz3.gene2 MhA1_Contig210.frz3.gene2
Sequence
MKLYIVLSSIFYAIIWNLMALPFILFCCKRMTKRIIKIKQSNEQGKDEESLEENSDNCKE
TQSFHSSSESIRDSVYRTADDSIRSIYKSDCAKSDETEAKETAVGHFPILGYTSDGKGSQ
DWAVTTAHDFKVKILTGVQGENSEQLKQCAEIVRIFITSHLVELGLQHIDFKNKKKYYNT
HIYPSSTDKSGYSAGPAIAISVISALKGKGALNELSPRRDCDPNKEWECADGLCIPISSL
CDGKEDCVLDVEERAFALGMLLHRPSDELYCPTGKYLND
Download sequence
Identical sequences A0A1I8BEK6
MhA1_Contig210.frz3.gene2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]