SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MhA1_Contig210.frz3.gene4 from Meloidogyne hapla

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MhA1_Contig210.frz3.gene4
Domain Number 1 Region: 176-208
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000668
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 2 Region: 47-114
Classification Level Classification E-value
Superfamily SEA domain 0.0000222
Family SEA domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MhA1_Contig210.frz3.gene4
Sequence length 233
Comment MhA1_Contig210.frz3.gene4 MhA1_Contig210.frz3.gene4
Sequence
MMASCHHSKFIFIILFLIQILFNSILCPLPPPTRHLARNVIRIVLNLPEQPFSQHLNHNT
SHEFKQTAENINEAFNLFWQTEPSYRGSRVIRLRYNQVLGTIATIDLIFELPLNTSIAVL
HRPFSSPTLACPDGSLPEFSIHGSTYCWSHSVCPSGTACEHGQCCKNAELTPRRNCDPIK
EWECADGLCIPISFRCDGKEDCVLDVEERAFALGMLLHRPSDELYCPTGKLIV
Download sequence
Identical sequences A0A1I8BFF6
MhA1_Contig210.frz3.gene4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]