SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MhA1_Contig210.frz3.gene6 from Meloidogyne hapla

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MhA1_Contig210.frz3.gene6
Domain Number 1 Region: 23-59
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MhA1_Contig210.frz3.gene6
Sequence length 70
Comment MhA1_Contig210.frz3.gene6 MhA1_Contig210.frz3.gene6
Sequence
MSLNPKRSVQPSHAFAASKASEDCLAGSFVCREDRTCISPDLVCDRKYDCADQTDEKTCG
ELNIFNYNFE
Download sequence
Identical sequences A0A1I8BFG0
MhA1_Contig210.frz3.gene6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]