SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MhA1_Contig210.frz3.gene7 from Meloidogyne hapla

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MhA1_Contig210.frz3.gene7
Domain Number 1 Region: 79-121
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000759
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 2 Region: 22-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000127
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 3 Region: 165-200
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MhA1_Contig210.frz3.gene7
Sequence length 213
Comment MhA1_Contig210.frz3.gene7 MhA1_Contig210.frz3.gene7
Sequence
MQAKAKQLEEERLKKEKDKEGQCGPEEVPCPETATIRCIHYTSLCDNVDDCGDGYDESNC
VSSESRDEEKIITISPENVINAYCAPGEFQCRDGSCIPDSSRCNRNYDCGLTDGSDEEGC
AYWKEAEEAERRRKEEEQKQLAEYHEQQRQRAEEEKNRRIEECRRRGGFLCPGQDKCVER
SNVCDGRSDCANGDDEKNCPVSEEETGWFINFI
Download sequence
Identical sequences A0A1I8BEN1
MhA1_Contig210.frz3.gene7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]