SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MhA1_Contig2416.frz3.gene2 from Meloidogyne hapla

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MhA1_Contig2416.frz3.gene2
Domain Number 1 Region: 178-213
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.0026
Further Details:      
 
Weak hits

Sequence:  MhA1_Contig2416.frz3.gene2
Domain Number - Region: 31-123
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00712
Family Spermadhesin, CUB domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MhA1_Contig2416.frz3.gene2
Sequence length 224
Comment MhA1_Contig2416.frz3.gene2 MhA1_Contig2416.frz3.gene2
Sequence
MFLYKNIIYHFLLILQFLFLINSQKTEKPIEDCGNQINPFGGRISLDGQEALIGHKIDCI
WLIIGQKSSQNFSFPISSDFPHFDHISLHVDKFYLKGENLKLEIREGINFEGNILIELEG
EQSTKQLIQKQSEQGFEVPPLNNLENKEIGFYVRLRGKIENISGLSIPYTYFYRWPAPPC
ATVEEFYCDNHKCISNILRCDGYDHCGDSSDEMCSNFKGETHIE
Download sequence
Identical sequences A0A1I8BI77
MhA1_Contig2416.frz3.gene2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]