SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MhA1_Contig2462.frz3.gene1 from Meloidogyne hapla

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MhA1_Contig2462.frz3.gene1
Domain Number 1 Region: 167-233,266-305
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000089
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 
Domain Number 2 Region: 22-118
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000017
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Weak hits

Sequence:  MhA1_Contig2462.frz3.gene1
Domain Number - Region: 378-408
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00497
Family LDL receptor-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MhA1_Contig2462.frz3.gene1
Sequence length 412
Comment MhA1_Contig2462.frz3.gene1 MhA1_Contig2462.frz3.gene1
Sequence
MSLASNNQTKLRKLMVIKKKGYGFISSTGYPKDGYERVKCAVNLEAKEGSGLVINIKFLD
LDLEPRYSRSDQCLRDYIVLTFIDREGLEHTSERICGNQKPELIQSMQSKLRVLFIATSP
PLQHYLPNTNTSKRWKGFKLRFDFVKEETISVITSQFNDQNKRYRSECGGANLPNTLSEN
IQSPGFPSTYPPNVNCFWLIRVVPNKRIYIKIIDLELSPTLDYERAILSLIDGYSFGISS
EEENQKINENNQKSSKILNFGSPRRDTKSISFYGNKSYYTEEGSLSYLSESNRVIIQFMT
SDGPTQNQLAEYKKNNSPIGFRLLWTEVLSLIATSSDFPLNTDNENSVSQEENLDVITSD
LCPGFVCLGGYFCLDSQSSVCVERNRLCINETLRCDGISNCAENDDSDEQYC
Download sequence
Identical sequences A0A1I8BHV6
MhA1_Contig2462.frz3.gene1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]