SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MhA1_Contig104.frz3.gene17 from Meloidogyne hapla

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MhA1_Contig104.frz3.gene17
Domain Number 1 Region: 561-754
Classification Level Classification E-value
Superfamily Sec7 domain 3.66e-73
Family Sec7 domain 0.00000282
Further Details:      
 
Domain Number 2 Region: 71-196,306-530,810-885,1136-1214,1288-1426,1627-1712
Classification Level Classification E-value
Superfamily ARM repeat 1.26e-19
Family MIF4G domain-like 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MhA1_Contig104.frz3.gene17
Sequence length 1725
Comment MhA1_Contig104.frz3.gene17 MhA1_Contig104.frz3.gene17
Sequence
MFLKASIERILNDAGTRRKENAELRKACEESLERLNAELQTFGQQQTENGMGPSCAILPN
GNNIFLADRYFPPFELACQNKSSKIVINALDSLQKLISYGHLIGNQPDSDNPEQLLIDRV
VQAICAPFQGPHTDDAVQLQIIKGILALILNQTCRIHESSLLLAVRTCFNIYLASKSPIN
QSTAKGILTQTINYVFTNMERTVTETVVIPFDENTVVKDVLDSVVYQVSTSLDSCQYENA
EQDRKSTNIDFNEPLSPNEQNIILNGSIHSSSPSYYYGMNGSSENTDLNITANGSIGTPR
QQLQQKLEFNSIEEKDAFLIFRALCKLSMKHLPDEQDPRSHELRSKILSLEMILLVMEHI
NGQPLPDHHSFVYAIRHFLCVALTQNAVSPTITVFEKALSIIVQLINKWKSHLKKQLEVF
FKEILLSILESPSSSFEHKWAVLNALSKIFDDSQSVVDIYVNYDCHMTSANIFEELISHL
AKIASSYSSDPSSPTHGQQIAKDREKRMRELALKCLVKALKCLVAWYEDMEIGKEVSIQY
PTEEQQQPLQLSSEGSAADVNQIVQVKQQKSLIESGIDLFAKKPAQGLAFLHSKGFIGTE
PEDIASFFHAEERLDKSVIGDYLGDGDSHNQKVMYAYVDTFDFSGVNIVQALRTLLNKFR
LPGEAQKIDRIMEKFASRYCECNPQLKIFASADTAYVLSYSIIMLTTDLHNPQVKRKMLK
EEYIRMNRGINGQDDLPDEFLSKIYDDIAANEIKTKPGNLKRPKLNAETATIRQRKIFQN
LELESISQVAHSLMEAATFTHVEFTTAKHFEQVQLMFELIWSFCLAAFSIGLQSSEDPAI
WRCCLQGFSEGVRVACLFRLTVQREAFVQALTKFTLLTANSSLSEMRPKNVETIKLLIQI
GVENGNYLEQCWYDVLKCISQLELVQSISTGNHGVFHLVLEKYPIQWHRNPIKHPIVYLE
DQLNDQIQNFIFIKDNVKSLFNIREKSIHAVQSCLDETSSQDVVVAIDRIFQDSSKLTGD
AIIQFVRALCQVSLEELCSPGGPSMFMLQKIVEISFYNMNRIRIEWSMIWSVLGEHFNLV
LKAGCSSNGNISHFALEALRQLSMKFLEKGELPNFRFQKEFLHPFEVIMDRNRSLACREM
IVTCVTHMVHSHADKIRSGWRNIFSLFSMAATEKDERIVEQAFTTTAEIIGDVFPKHFAE
LSPDSFHDAIKCLSGFACNPAFPDTSMESIRMIRLAAALVDKHSDLINANWGNNSGRPES
FKDLSSIEGHPIWIKGWLPIIFELSCIVNRCKLDVRTRSLTVLFELVKSYGAKFGDDAWT
DFFKIIFRIFDFGKIDELGNEKNEWMITTCNHALYAIVDVFSEYYVSLGPLLLPEVYKQL
YWCVEQGNELLARSAINCLENLVVSNGNKFNKQMWDQTTEQLVKIFDCSVVDVDSTESLT
NAHSVKSTTGSPSTTPNDESSGSFEDCVLLSSITRCIIQLEIVDAVSNILFGRNAFKVEP
PAKRPSTFTGERGNGGGEGRSEDSFSIGELPVTDFLIVFERLLFSQAMFQYLSTQNLMCL
ADALLGSHAMARRLSSNTAAQRNLLWKATFKGRSKPNMQKLEAHSIHCALNILFQLYSQS
SNVEPEIVEMFRKQLQKTVKYALEHYLTSHSDTFRSYWLTVVQMILNRTCDLPNDRFAEL
GVEFRLSLTSLIESEEQPIIRSALHRVVQRFITHEHPNSYVNNIS
Download sequence
Identical sequences A0A1I8AWW9
MhA1_Contig104.frz3.gene17

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]