SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MhA1_Contig1140.frz3.gene19 from Meloidogyne hapla

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MhA1_Contig1140.frz3.gene19
Domain Number 1 Region: 157-194
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 196-226
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000877
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 3 Region: 124-157
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000089
Family LDL receptor-like module 0.002
Further Details:      
 
Weak hits

Sequence:  MhA1_Contig1140.frz3.gene19
Domain Number - Region: 57-111
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00165
Family Tachycitin 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MhA1_Contig1140.frz3.gene19
Sequence length 228
Comment MhA1_Contig1140.frz3.gene19 MhA1_Contig1140.frz3.gene19
Sequence
MFFNYLLISGIFIFLIISIYCNLINEVVIINKSEPNVPNYCNNSNLIQQSGLIRAPMGQF
LGFPCSNEFYHCRWQSDGYRTYRKNCRTGLVYDVVGTQNCNYDYNVKGCSTGENSVAVNC
TAIKDFKCPLSEDCVPLSKRCDGNYDCVLEEDEQNCPMCKSIQFPCVVSEQCIPIGQRCN
GIKDCEDGTDELDCENCGSGKFFCRKSGKCIQAKERCDGYPHCPNGIK
Download sequence
Identical sequences A0A1I8AZS7
MhA1_Contig1140.frz3.gene19

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]