SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MhA1_Contig1140.frz3.gene20 from Meloidogyne hapla

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MhA1_Contig1140.frz3.gene20
Domain Number - Region: 2-35
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00016
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MhA1_Contig1140.frz3.gene20
Sequence length 438
Comment MhA1_Contig1140.frz3.gene20 MhA1_Contig1140.frz3.gene20
Sequence
MFLCESGTQQINQKQVCDGIVNCKYDGSDEKYCQRSTGFEKQKNEIEFQANLAEEIKEPK
INENELKQNSNFAFDQPPQLEELKEFRLHKDQQNKNNLEISPSSNNIQLKEKQQNLPLIN
SIAFQFEKPKSQENTKIPSINFIPGDYQTDVLNELNGEEIKQENFPLPSVSERIENNTLI
NQQEEEQNNLIMRPSNELRIEPFEQQKNNILINEKEKIEEKNKIEEINECKNKLNNNIKN
NNLNNQNKTNCEEIKLTTNSLILNEKLNNNLTKNEIKNNGNNKEENEGKIKEKNSKQNNL
LFTTIMPTQEEIVENNENNQEKDLLKNMAEKMRKMKVFEEKEEKVVENEEEENKSEENKL
YEDEDENEEEEQKQILKRLYSKYGRRRANAERRLICEGDEMSFCDVCATHKSFCEAIFCS
SPLLLFSSVMKLENECRE
Download sequence
Identical sequences A0A1I8AZL3
MhA1_Contig1140.frz3.gene20

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]