SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MhA1_Contig121.frz3.gene83 from Meloidogyne hapla

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MhA1_Contig121.frz3.gene83
Domain Number 1 Region: 301-399
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.55e-17
Family Ras-binding domain, RBD 0.011
Further Details:      
 
Domain Number 2 Region: 445-556
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000438
Family Pleckstrin-homology domain (PH domain) 0.0099
Further Details:      
 
Weak hits

Sequence:  MhA1_Contig121.frz3.gene83
Domain Number - Region: 659-695
Classification Level Classification E-value
Superfamily Ganglioside M2 (gm2) activator 0.0432
Family Ganglioside M2 (gm2) activator 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MhA1_Contig121.frz3.gene83
Sequence length 797
Comment MhA1_Contig121.frz3.gene83 MhA1_Contig121.frz3.gene83
Sequence
MSANTFSSTSSTSTLLRSIAPPIGEQNKEEKDAHKQIFTTHLKTTNRQQSNDQTTLHSVV
VKQRPAVPPKPQLDIVRFSMAQARDEIDLDTILTELLELEEQLSGEAGDRLVLGLPTLSS
YTQKHLPSTKDSQLTTQLPSPQMVDQQQHVTFQHFINENSNSSVKSFPTGSSSSNSHLHT
TQTNGLDFNDCDSAFGDSSSTESASQIPSNGNALLLPRNAAICNSEFSSADSFRGSLNTP
SPTRQLILNSGQQNGTQLSCPTSSLFSGGPRPPSSAGSYNSAVATSNDENKKAKIREALE
KMKEAKMKKIFVKIFLEDGTQRGILLDERWTVTDTMKHLAVKLNCALTPAHAIVEKYPKL
LIKRIYEDNEFVVENLEEWGENSPNELHFVRMHYKWSLFHSPQQFLLTDRNRSDFPSINQ
VADWDSLQKQRLLESYLGDNTSGSGGRVPELEGWLLLKLDGKKSWRRHFFVLRASGLYYV
PKPGKTRGPTCDLQCLMSVYMCTDWRKKYKAPTEWGFAIKHPRVQLKSSKFVKYICAEDE
YTFNQWISALRIIKNGFSTLYKAFRAAHVSPVHVDSCSLSVHVEIPQVPFQNNLRSPIGI
HSPCRRPPYVSASPCSTPGFVGSPVAMRADIGMPHSLRTSSDTRFGSPTTQSGRLAFERD
FCNTIKRQPDPTNSVISQQHQQNNFVHCPFTENFFESANIHTNRVEENDSDEADEEFFPL
PPPPSSLPTSPIRASKRLPPPPPKRAEGTRLQSIQTIDLPSTTTSVKQPLQMDLMAELTL
ATNRQKKRIENRISNNN
Download sequence
Identical sequences A0A1I8B1C9
MhA1_Contig121.frz3.gene83

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]