SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MhA1_Contig1377.frz3.gene3 from Meloidogyne hapla

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MhA1_Contig1377.frz3.gene3
Domain Number 1 Region: 2060-2234
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-37
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 2669-2824
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.02e-29
Family Laminin G-like module 0.00097
Further Details:      
 
Domain Number 3 Region: 2470-2651
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.9e-25
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 1258-1277,1867-2048
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-24
Family Laminin G-like module 0.0056
Further Details:      
 
Domain Number 5 Region: 2248-2412
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000102
Family Laminin G-like module 0.028
Further Details:      
 
Domain Number 6 Region: 638-688
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000017
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 7 Region: 547-595
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000254
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 8 Region: 985-1037
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000446
Family Laminin-type module 0.0049
Further Details:      
 
Domain Number 9 Region: 1093-1147
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000117
Family Laminin-type module 0.005
Further Details:      
 
Domain Number 10 Region: 1043-1095
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000117
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 11 Region: 1193-1242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000117
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 12 Region: 946-987
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000248
Family Laminin-type module 0.047
Further Details:      
 
Domain Number 13 Region: 1146-1191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000753
Family Laminin-type module 0.014
Further Details:      
 
Weak hits

Sequence:  MhA1_Contig1377.frz3.gene3
Domain Number - Region: 1746-1845
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00012
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.017
Further Details:      
 
Domain Number - Region: 593-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000642
Family Laminin-type module 0.02
Further Details:      
 
Domain Number - Region: 686-735
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00204
Family Laminin-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MhA1_Contig1377.frz3.gene3
Sequence length 2852
Comment MhA1_Contig1377.frz3.gene3 MhA1_Contig1377.frz3.gene3
Sequence
MNREFNISSDNYEAEDGHLPDGKNVRYAINKDQFPDFSWRGFVVFSTIQEQINLDVIIRK
SAVYKLLAHYRNPTEVDVELEAKFVPLQTQTSDSEQTAKVILPPSGQQSQSAFIQSKPDQ
RPFVLNPGRWQLQLSAHKRLFLDYVVLIPSEYYQGSQLSEHILEPCKAGQTQNCIDLLYP
PMPVVATVRADTGITKFEELVPGTDKVQAILSHSPDSLLPQKVGQGALVKTEDQSKEIRV
GITVPENGIYLLIADYHSQEPNAVPVRIRVEQGQKPGEEPPLIASPSTAAEGLLLINHCP
YGFFCRELMSSDGRAAKLGLNKSPPDAQVILSVQPGRQFSLGAFTLVKEEKWHGDLLKQK
SHCVMKGEKCIAQQFPQPPKSIRTEAESGNNINSSISSDKLPFQIAGEPAEVRLMSLDTV
QSTLEIEGVVDSPGQYVFVVHYYSPDNPPVFTDVLVQNDFADAMFHYCPSISGCRTIIYT
IPDYILPVPFESFTDSVLKPSPLGLADEFVEECAAENFGNRPENVSDYCRSKIFSITSEF
IGAAMACDCNPQGSLDFACADYGGQCKCKPNVIGRSCERCAPGYYNFPDCLKCKCGTKQQ
CDERTGQCFCPRYVEGLACDRCVQYAYGFDPLIGCQLCGCSVNGSAGAEKRCDPISGQCL
CKDNVGGRRCEKCLQGYWAFPECRECDCQQSGTTDDVCDDRTSRCLCKKNLLSGGRCDRC
RPGTFDLRKSDPDGCSECFCFRVTDRCRSSNWPIRGLRVSEKDWKVDDPNGTVLIDEFGR
IVYEAGKEFNEGEKEEKTLQQTSSVYFEVDLQPGVDYTRMYGLHLSFAISSFPRDDRPRP
NTKADVRLIAGNTVLEYWATEQPRNASQRFNVVVTLLPESWLELQGVPANRAQLMLVLLR
LQRIQVKASYYERPSKAILEHFQLEMADTGAPTTDENGIDRPMASSVELCECPSAYSGPS
CQECAPGYYRLPIQSGQLLGSCVPCKCNGHSGTCDPATGVCLNCQHNTEGEHCEYCREGF
YGNATTGSAAACLRCPCPHPIESNNFARSCSVSELGILERCECHEGYIGDRCEMCDTGFF
GNPIIPNGRCENCDCNGNNDLKNPAACHPQTGDCALCEHNTDGRHCEICTQWFWGDALNA
KNCTKCECHQCGSSVCDHYTGQCQCHLLVEGTRCDRCVENAWGLDSCRGCQPCNCGLAAS
NSQCDLKTGQCACMPGAAGQFCERCDNGFWRYSSQGCQKCDCEADLSMGTVCDVNTGQCH
CQEGATGSRCDKCLPKYLRVPGYGCRLCDECVYALAQETDQMEANVAHLRSLLANVSSET
LTGARLNRIQKQIGELEPALESVIASNSPEAEEIASQFAPKARSLNEAVSAAAIRAQRAT
EQLSTLDKRLDKSYEELGEIRTNAQQLLEMTRLTVDKIGKLGRRFETQAPLDINREELRN
QSEEKLKMIRKLDGGIEEALSEAKKHLVNVMATQERIGELKGRNEELSNKIGEERERLGK
LNEWREAFEEELHTVKSSLADSLDSRSMFSLRALIDGIEKDVKSIERSSSEQESHLGNIT
NLLEEITSQRTIIDQLLSELSELKNQLPPIDDNTFRKRRETEKAIKQKLQHKVAQLETEA
QKVVGIYDAARLEAKRAMEAANIYKEVIEGMKQARIQSLDAENRMREAGEQMRAQNGSAK
EARAKSKMLKEQSSSLDAEALREAKARADTLTKREEQLTPLIAKIRNDLSEISQQSLKGE
TLAGGDKRQLLLDIDTIREQADQTQQRVEPLNESFKQMGQQLEDVDKRVRELMDSSGKAS
EDTATARDQIQQVIKAMPELKEEWEDSQKRIDQTIANVKETRSKLALLKEKVLLARDKAN
RIKLGAHFERGSYLELPLPQTSDDFASITDVRFFFRTREQNGFLFFLGSSNAQLAGEFLG
IELEHKRPKMTLNLGGRAASLLHMATPVNDMKWRELAVQRKGKRATMKLSKPGGNVDEPE
EEKSIELTAGKSILNFFDDLRHLFVGGIPPNFLLPSALQQRHFMGDLDKLIVNGELIGFW
NSEKSHGISGSEMRQLPDSEKTAENGVTFNGRGYLQMDVGPWNPRKRTAIMLSFLSYSPD
GLLFFVGKDRDQLVLELVGGRISLLFDLGSGPAKLVSNEENYNDGKWHLVEVDRTEKAAK
LQVDGTDKVEGETPGSLFEMSVSDSFFLGGLPTSIETTRFAVHPFRGCIRNLKLDADYIS
LARPKASKGVQSSCVNRDVRVGTLLSERSFAQFTGLSLNGQLELCFRFRPAISISSEQEV
HLLSVMVNNDQEELLRVHLEDGGRFLAIRPNGDDTGLIRTELSHRLSGGWHHLCVLRNSK
IMHIFVDDVIDEQREAPIEGIDLLNSNDVLLGFGRLESSPSFVGCIGDILLGGQLLSLAQ
SSANELTLSGCSIAGLNEFPSSIDESMPDIPLPVVNAEQRQPKEESKKGEIDENKIISST
PSAKVRPEGECALPLKPHGEREDSSGMRFGLSPNARLEFDVGQITGTDLLFTLELRATAA
NGIILFATDERHSQFIVIYLLNGKPAFSSKSAFGQLTITSTKSLLDGEWHSIRAQREGPA
SALYIDGQLNVQNISDELTINSIDHLNLQKTLFIGGLPLELVPFAARLLPGVKSEFGGCL
RNFGFNGRQLEELPLKEIGTVPCSQFKEPGLFFGKEGGYAILDRQLVVGTSFSLELELKP
RTKNAVIVSVGVLEFLSLQLLNGSVKFSVDNGNGVESVLFEPPIGTSLCDGHWHQVKIYK
KKKLLTLNVDGKSSLRVLGKKSASETSTHDPLYLGGVPRDVKLKGLDTQEPYVGCIRVIF
LGKKNRRRNVPDELAQELELFGSVDRNYCPLN
Download sequence
Identical sequences A0A1I8B5M8
MhA1_Contig1377.frz3.gene3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]