SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MhA1_Contig373.frz3.gene10 from Meloidogyne hapla

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MhA1_Contig373.frz3.gene10
Domain Number 1 Region: 1524-1664
Classification Level Classification E-value
Superfamily SET domain 1.14e-48
Family Histone lysine methyltransferases 0.0045
Further Details:      
 
Domain Number 2 Region: 73-117,147-199
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000522
Family Canonical RBD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MhA1_Contig373.frz3.gene10
Sequence length 1667
Comment MhA1_Contig373.frz3.gene10 MhA1_Contig373.frz3.gene10
Sequence
MQQSQEPCSVSNNLTQQQIKPSWRRFTNPTDPESKLPVFRVFGVCEEFPQFNVTTLQDPR
RPPDPRKIVKLAACDLPVPEFMLDDEYCAIPPRREVALVGLNDNIDEKFLLQLCKKITHT
SATNLLTPSNDTEEASSLSTPFVSTSGITPLQIKILRHPTTGRHLGMALIDFFTCRDGKL
FILRHHGRPMMGREVQCFFDPFVYKLGELYKLRVGEELELPERYRFIFNERTIQHIRSLL
TLKYKDEAKSEAESEAKKATNLENGLSSKEKTSSNKKSNTKQREHRRSIKEDLKQTPIIS
SQDPPLLTVKSEVPEASTAVLTTTNNDAQNHSVERLDFTPINPSDSTSLNTTINSINSTL
PTTTTPTKSLDSLKQLPSQLSSPCSTSLSFLPPIALVTPKKTADNKIVILEHEPQQQNIV
NNSTGGNLNSSGGGDSLKQETSPISTSSPIPPQQQSLESRLAALLTRRSTTNLSSTKLST
SNEDIEASAAIEAEKDKSPSKPIESTTTFKSPSSDTANASSSSTSSSSTTQCTSRPQSQD
SNKPNNDFNKIITDPSCSNFGSEPFDEEFCQNGFEKWKDAKSIWNRDGERWNQDGERWKE
RERNFSRDKDRNYRQQRRSQPTAYQQRQRYGNYHSNHHHNNNHQNRYQQRTFNNRYENSG
RFDYSNQFYQNGNNHRFSGPRGPPQPLFVPRINGRFPMTPIRPPPINETDLAFASSQVYK
NDQMAYPRRRTMERDKFSITLQYTINAMTSMLSLAVKQDIDRRVETEALKILDKIYEERL
EEAKKRRQLADENENNQDSQNPLNIDQGDGQKRLALQTIRNGGNLLDQLFNFNNVGGNGE
KGYNGSTLIFNLDQKTGLFGISHSARITALPRIRRKPKPPTPEPIPLKSINRKRSTTIRD
DENEKVGPRRKHLRLNEEDKVKARARTTSICSDSISSTRSPSIASASSRSVSPSASSTTS
DSSDEEDEVSQQASTIASDTDEEEEIKENKNDNILKKQNLAEVDGCEKLRVSEAMNEGSE
RLKTTKSTTLSLDLDLEVQPLLEEKDQPETMNKNINIIGTAECARFILYDRNMVVLEKDK
NIKSKSIQSRRSSPHLVSIPSSIKKEVQDVYESPISATKSPDKKSSSPTKKKKKHFHLSG
DYAEWPSTIAVSRLQMSSPLSTKNWPKRSFEEEQEAIFCFEKEGLALEEVAYLRMVVELL
GDDFILENKIPENVLNNVFRHQHGLPLLKWVEPEDAVEIDPPMPIYWQSSKPPSNKIYFY
NDIELDGIIPNPSGCARTEGNYVRKKDRQKMEQIKTGAPRHTLMRRATSSSTPQTNEPHL
LKTTISTQDEIIARHMSQALKSERAIIRSIGNSLFSSSFSSNNSNNNSNKNNNNSQQDNT
NLVDEATTSSSNLTTAINFASSLRGNQLKDITRGTPQNPQSNNQDVQKEEDKQSSSSLIT
KTNKKTNLSGGGSSNKNLNNLINLNIDNDLVGYPVNTKKRYLLTCSSNNNGGGTSSNDII
LNNNDGGGGVFNNSKESRSCVGSKYRSKMIKFARSRIHGWGLFSLEPIAPDEMIVEYIGE
KIRPEVANTRELAYERQGIGSSYLFRIDENVVIDATKKGNFARFINHSCQPNCYAKVLTV
QGEKRIVIYSKRFIQKGEEITYDYKFPLEDEKIPCLCGASQCRGYLN
Download sequence
Identical sequences A0A1I8BP68
MhA1_Contig373.frz3.gene10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]