SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MhA1_Contig469.frz3.gene8 from Meloidogyne hapla

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MhA1_Contig469.frz3.gene8
Domain Number 1 Region: 1-146
Classification Level Classification E-value
Superfamily vWA-like 3.26e-37
Family Integrin A (or I) domain 0.0000474
Further Details:      
 
Domain Number 2 Region: 156-234
Classification Level Classification E-value
Superfamily Integrin domains 9.94e-20
Family Integrin domains 0.0011
Further Details:      
 
Domain Number 3 Region: 337-387
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000445
Family Integrin beta tail domain 0.0087
Further Details:      
 
Domain Number 4 Region: 248-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000112
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Domain Number 5 Region: 290-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000156
Family Integrin beta EGF-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MhA1_Contig469.frz3.gene8
Sequence length 398
Comment MhA1_Contig469.frz3.gene8 MhA1_Contig469.frz3.gene8
Sequence
MDLSYSMKDDKEKLSQLGDLLADRMRSITKNFRLGFGSFIDKKVMPFVDPRKEKQKEVDR
AQISGNLDAPEGGFDAVMQAITCNDSIGWRERSRKMIVFSTDAGFHFAGDGRLADALPDI
STAVGVLANDSSNIVTLIEEEYGRIAEKIIMVDDANPSMGLKLSYRSKCMDGRTLMDTNV
CDGVKVGDEVEFEVTLEALHCVQQRDFELHVGPSGMEEVLLLDVHVICDCDCEREANPDE
IVSGQFCECDNFNCPRHDRLLCGGHGDCVCGTCQCLPGFTGPACECPISQETCIAPNGKV
CGGHGECICGKCHCFTDEDGSRYSGPYCDICPTCPSKCVEYKPCVMCQQWGTGPYNETKC
AECPFVVIPVEELPQLNVSDSDSWNECQVVINWKKKNE
Download sequence
Identical sequences A0A1I8BRE4
MhA1_Contig469.frz3.gene8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]