SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MhA1_Contig825.frz3.gene9 from Meloidogyne hapla

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MhA1_Contig825.frz3.gene9
Domain Number 1 Region: 395-488
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.00000000000000327
Family Mannose 6-phosphate receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 46-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000471
Family LDL receptor-like module 0.0053
Further Details:      
 
Domain Number 3 Region: 209-302
Classification Level Classification E-value
Superfamily EF-hand 0.0000742
Family Polcalcin 0.072
Further Details:      
 
Weak hits

Sequence:  MhA1_Contig825.frz3.gene9
Domain Number - Region: 79-118
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000484
Family LDL receptor-like module 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MhA1_Contig825.frz3.gene9
Sequence length 503
Comment MhA1_Contig825.frz3.gene9 MhA1_Contig825.frz3.gene9
Sequence
MMITRYLFVFILFHNLFVLFAEDSSTKTLLPRGVYPQLASFYSGGETFACLDGNKVIPFN
QVNDDYCDCADGSDEPGTAACRNGKFYCSNYGYKPSLIPSSRVNDYICDCCDGSDEWDSG
IECPNICEALGSEARSEAKQRRVTHEAGWRKREELALEGKKIMEEKTKELEKQKGELSSL
EQRKLEMEEAKNVAEKLESDAKREVDEQWEIEKNRKLTEKAENLLKQIDNDGNGKISNDE
LRIYAGLEPQKLLPPENKLNEESENVDNNLLELEEMLKGIFVEGNENIDLEILKNKFKNI
NDFLIKCAEKKQKENEEDGKEENEEKEDEIDGPKYDEETQKLIENANIARKEFEEVESQI
GQFQDDIRNSEQFLNQEYGTDYAWAPLKGQCAELTTTQYTYKICLFDRTIQKDRNGHNEV
DLGHWGNWSGPEINKFSLQKYEHGQSCWNGPERSTLVELVCGAELELVEASEPAKCEYKF
LVRAPAACQDLKEMDVGESHFEL
Download sequence
Identical sequences A0A1I8C093
MhA1_Contig825.frz3.gene9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]