SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336235820|ref|YP_004588436.1| from Geobacillus thermoglucosidasius C56-YS93

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336235820|ref|YP_004588436.1|
Domain Number 1 Region: 4-158
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.36e-31
Family SMI1/KNR4-like 0.009
Further Details:      
 
Domain Number 2 Region: 203-254
Classification Level Classification E-value
Superfamily ARM repeat 0.0000504
Family HEAT repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336235820|ref|YP_004588436.1|
Sequence length 262
Comment cell wall assembly/cell proliferation coordinating protein [Geobacillus thermoglucosidasius C56-YS93]
Sequence
MTIWANLESDIYKLPPLRESDIKKAENLFNVKLPKSYLDILKIQNGGSIVFNAHPSPKPT
SWSDHSVNVDFIMGIGENNGILETPYYIEEWQMPEGLILISGQGHSWIAFDYRNTVENPP
IVYIDNETEEIFQIADSFESFLENLYVEEREEEIEFGEFDEIEISKESTMRAIYNNDIDG
IITSVDLMSQEVKAEDLKWFSSVLLQLSKHPNDDVRRSVAEATNFLADSLERNTVKKLIE
IFNQDNSEDVRYFANTISNQIS
Download sequence
Identical sequences A0A0F6BNU7 A0A1Y3Q5Z9
WP_013401104.1.100411 WP_013401104.1.10372 WP_013401104.1.15103 WP_013401104.1.21702 WP_013401104.1.44525 WP_013401104.1.50686 WP_013401104.1.65251 gi|336235820|ref|YP_004588436.1| gi|312111393|ref|YP_003989709.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]